PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I02520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 332aa    MW: 36564.4 Da    PI: 7.2354
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I02520.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1805.9e-5651301128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelv++yL++kv++  + + ++i++vd++k+ePwdLp k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke+++ 
  Pahal.I02520.1   5 LPPGFRFHPTDEELVTYYLTRKVSDFAFAT-RAIADVDLNKCEPWDLPGKASMGEKEWYFFSMRDRKYPTGIRTNRATDSGYWKTTGKDKEIFH- 97 
                     79*************************999.89***************988999****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      g lvg+kktLvfy+grapkgekt+Wvmheyrl
  Pahal.I02520.1  98 CGMLVGMKKTLVFYRGRAPKGEKTSWVMHEYRL 130
                     99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-643151IPR003441NAC domain
PROSITE profilePS5100560.3775151IPR003441NAC domain
PfamPF023652.7E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELVT YYLTRKVSDF AFATRAIADV DLNKCEPWDL PGKASMGEKE  60
WYFFSMRDRK YPTGIRTNRA TDSGYWKTTG KDKEIFHCGM LVGMKKTLVF YRGRAPKGEK  120
TSWVMHEYRL QNKFPYKPNK EEWVVCRVFK KCQIIKMRPP QGSPTMDDSP CHDGNASLGE  180
LGELDVSSIL GSFTPAAAHA SSTSSPGALH QGAGESFGHR MDINAYMSWM AAANQGAAAA  240
AAAAMLPWAT TPGLFGNVFA PNHQLVQKPL PFAGCSQPRD FGGVAANVGS EHAMFASSLA  300
KVEMECDQQQ QQPAPAPEQQ LGMDESTWRA F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-57515117165NO APICAL MERISTEM PROTEIN
1ut4_B9e-57515117165NO APICAL MERISTEM PROTEIN
1ut7_A9e-57515117165NO APICAL MERISTEM PROTEIN
1ut7_B9e-57515117165NO APICAL MERISTEM PROTEIN
3swm_A1e-56515120168NAC domain-containing protein 19
3swm_B1e-56515120168NAC domain-containing protein 19
3swm_C1e-56515120168NAC domain-containing protein 19
3swm_D1e-56515120168NAC domain-containing protein 19
3swp_A1e-56515120168NAC domain-containing protein 19
3swp_B1e-56515120168NAC domain-containing protein 19
3swp_C1e-56515120168NAC domain-containing protein 19
3swp_D1e-56515120168NAC domain-containing protein 19
4dul_A9e-57515117165NAC domain-containing protein 19
4dul_B9e-57515117165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631710.0AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982400.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLK4ACC80.0K4ACC8_SETIT; Uncharacterized protein
STRINGSi036535m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-92NAC domain containing protein 58